@currents/mcp

MCPcommunity
v2.3.1Currents Software IncApache-2.0Updated 3mo agonpmGitHub

Currents MCP server

!Unit Tests Give your AI coding agents full visibility into your CI test results. The Currents MCP Server connects tools like Cursor and Claude directly to your Currents dashboard, so agents can diagnose flaky tests, pinpoint failures, and act on real execution data -- without leaving your editor. - Query runs, spec files, and individual test results from CI - Surface error trends and performance…

Automatically indexed from public sources. Not yet verified by the developer on Forge.Claim this listing →
15kDownloads/wk
3mo agoLast update
Package
AuthorCurrents Software Inc
LicenseApache-2.0
Version2.3.1
Sourcenpm
Trust Status
B
60/100Good
Listed in Forge index+10/10
Publisher identity verified+0/20
Publisher: run `forge publish` from the package repo to claim ownership
Ed25519 publish signature+0/5
Included automatically when the publisher runs `forge publish`
Domain verification+0/5
Publisher: host /.well-known/forge.json on the package homepage with { "publisher": "<github-login>" }
npm Trusted Publishing (Sigstore)+0/5
Publish from GitHub Actions with --provenance so the attestation binds this package to this repo
npm maintainer match+0/5
Earned once your identity is verified above and that login is an npm maintainer of this package
CVE scan · clean+30/30
Static analysis · clean+20/20
Paste into Claude Code, Cursor, or any AI assistant to fix all gaps
StatusCommunity-indexed
PublisherUnverified
SignatureUnsigned
Domain
ProvenanceAttested · unverified by Forge
Dependencies60 resolved · 1 with advisories
Tool surface38 tools · 5 privileged
Security scan✓ Cleanv2.3.3 · 8d ago
EvalsNone
IndexedMay 24, 2026

Verification confirms publisher identity (repo ownership), not code safety. The security scan covers known CVEs and suspicious install scripts — it cannot prove the absence of malicious code.

About

!Unit Tests Give your AI coding agents full visibility into your CI test results. The Currents MCP Server connects tools like Cursor and Claude directly to your Currents dashboard, so agents can diagnose flaky tests, pinpoint failures, and act on real execution data -- without leaving your editor. - Query runs, spec files, and individual test results from CI - Surface error trends and performance metrics across your test suite - Manage quarantine rules, webhooks, and project settings programma

Keywords
currentsmcp-serverplaywrightdashboardreporting