@currents/mcp

MCPcommunity

v2.3.1Currents Software IncApache-2.0Updated 4mo agonpm GitHub

Currents MCP server

!Unit Tests Give your AI coding agents full visibility into your CI test results. The Currents MCP Server connects tools like Cursor and Claude directly to your Currents dashboard, so agents can diagnose flaky tests, pinpoint failures, and act on real execution data -- without leaving your editor. - Query runs, spec files, and individual test results from CI - Surface error trends and performance…

Works in

ClaudeCursorCopilotGemini

Inferred from the transports this listing declares (stdio). A client not listed here hasn’t been ruled out — it just isn’t something Forge can confirm.

Automatically indexed from public sources. Not yet verified by the developer on Forge.Claim this listing →

15kDownloads/wk

20GitHub stars

14Forks

4mo agoLast update

Package

AuthorCurrents Software Inc

LicenseApache-2.0

Version2.3.1

Sourcenpm

npm@currents/mcp

GitHubcurrents-dev/currents-mcp

SBOMCycloneDX 1.6 ↓

Trust Status

B

60/100Good

✓Listed in Forge index+10/10

—Publisher identity verified+0/20

→ Publisher: run `forge publish` from the package repo to claim ownership

—Ed25519 publish signature+0/5

→ Included automatically when the publisher runs `forge publish`

—Domain verification+0/5

→ Publisher: host /.well-known/forge.json on the package homepage with { "publisher": "<github-login>" }

—npm Trusted Publishing (Sigstore)+0/5

→ Publish from GitHub Actions with --provenance so the attestation binds this package to this repo

—npm maintainer match+0/5

→ Earned once your identity is verified above and that login is an npm maintainer of this package

✓CVE scan · clean+30/30

✓Static analysis · clean+20/20

Paste into Claude Code, Cursor, or any AI assistant to fix all gaps

StatusCommunity-indexed

PublisherUnverified

SignatureUnsigned

Domain—

ProvenanceAttested · unverified by Forge

Dependencies60 resolved · 1 with advisories

Tool surface38 tools · 5 privileged

Security scan✓ Cleanv2.3.3 · 1mo agoHow well does this scan work?

MODERATE@hono/node-server@1.19.17Node.js Adapter for Hono: Path traversal in `serve-static` on Windows via encoded backslash (`%5C`) · transitive

EvalsNone

IndexedMay 24, 2026

Verification confirms publisher identity (repo ownership), not code safety. The security scan covers known CVEs and suspicious install scripts.

Tools

38 tools · 5 privileged

Statically extracted from the published packagev2.3.3 · 1mo ago

Read out of the source npm actually ships, at scan time. The package was never executed. Tools registered dynamically at runtime, or hidden inside bundled or minified code, can be missed — so this is a floor on the tool surface, not a complete census of it.

Filter toolsPrivileged only

currents-list-actionsNo description published

This tool published no description. Forge does not invent one.

currents-create-actionNo description published

This tool published no description. Forge does not invent one.

currents-get-actionNo description published

This tool published no description. Forge does not invent one.

currents-update-actionNo description published

This tool published no description. Forge does not invent one.

currents-delete-actionprivilegedNo description published

This tool published no description. Forge does not invent one.

currents-enable-actionNo description published

This tool published no description. Forge does not invent one.

currents-disable-actionNo description published

This tool published no description. Forge does not invent one.

currents-list-affected-testsNo description published

This tool published no description. Forge does not invent one.

currents-get-affected-test-executionsprivilegedNo description published

This tool published no description. Forge does not invent one.

currents-get-affected-executionsprivilegedNo description published

This tool published no description. Forge does not invent one.

currents-get-projectsNo description published

This tool published no description. Forge does not invent one.

currents-get-projectNo description published

This tool published no description. Forge does not invent one.

currents-get-project-insightsNo description published

This tool published no description. Forge does not invent one.

currents-list-pull-requestsNo description published

This tool published no description. Forge does not invent one.

currents-list-project-termsNo description published

This tool published no description. Forge does not invent one.

currents-create-jira-issueNo description published

This tool published no description. Forge does not invent one.

currents-link-jira-issueNo description published

This tool published no description. Forge does not invent one.

currents-list-jira-projectsNo description published

This tool published no description. Forge does not invent one.

currents-list-jira-issue-typesNo description published

This tool published no description. Forge does not invent one.

currents-get-runsNo description published

This tool published no description. Forge does not invent one.

currents-get-run-detailsNo description published

This tool published no description. Forge does not invent one.

currents-find-runNo description published

This tool published no description. Forge does not invent one.

currents-cancel-runNo description published

This tool published no description. Forge does not invent one.

currents-reset-runNo description published

This tool published no description. Forge does not invent one.

currents-delete-runprivilegedNo description published

This tool published no description. Forge does not invent one.

currents-cancel-run-github-ciNo description published

This tool published no description. Forge does not invent one.

currents-get-spec-instanceNo description published

This tool published no description. Forge does not invent one.

currents-get-spec-files-performanceNo description published

This tool published no description. Forge does not invent one.

currents-get-tests-performanceNo description published

This tool published no description. Forge does not invent one.

currents-get-tests-signaturesNo description published

This tool published no description. Forge does not invent one.

currents-get-test-resultsNo description published

This tool published no description. Forge does not invent one.

currents-get-contextNo description published

This tool published no description. Forge does not invent one.

currents-get-errors-explorerNo description published

This tool published no description. Forge does not invent one.

currents-list-webhooksNo description published

This tool published no description. Forge does not invent one.

currents-create-webhookNo description published

This tool published no description. Forge does not invent one.

currents-get-webhookNo description published

This tool published no description. Forge does not invent one.

currents-update-webhookNo description published

This tool published no description. Forge does not invent one.

currents-delete-webhookprivilegedNo description published

This tool published no description. Forge does not invent one.

0 of 38 tools published a description.

Tool names and descriptions are written by the publisher and shown verbatim as inert text. They are the strings an MCP client passes to a model, so Forge scans them for prompt-injection patterns — any finding appears with the security scan above. “Privileged” is a keyword match on the tool name, not an audit of what the tool does: a benign-sounding name can still do anything.

About

!Unit Tests Give your AI coding agents full visibility into your CI test results. The Currents MCP Server connects tools like Cursor and Claude directly to your Currents dashboard, so agents can diagnose flaky tests, pinpoint failures, and act on real execution data -- without leaving your editor. - Query runs, spec files, and individual test results from CI - Surface error trends and performance metrics across your test suite - Manage quarantine rules, webhooks, and project settings programma

Keywords

currentsmcp-serverplaywrightdashboardreporting

Alternatives

Comparing tool surfaces…

Tools exposed

38 tools · 5 privileged · observed 2026-08-09 by static extraction. A tool surface is what one scan read on one day, not a live capability list.

Linked names open Forge’s index of every entry observed exposing that tool. Browse all indexed tools.

No dependency coverage

This package was last scanned before Forge began storing the resolved tree. The next scan will record it.

Topics

Related in analytics & dashboards

io.github.PostHog/mcpOfficial PostHog MCP Server for product analytics, feature flags, experiments, and more.
grafana/mcp-grafanaMCP server for Grafana — query dashboards, explore metrics, manage alerts
irinabuht12-oss/google-meta-ads-ga4-mcpMCP server for Google Ads, Meta Ads & GA4 — works with ChatGPT, Claude, Cursor, n8n, Winds
@digestseo/mcp-gscSelf-hostable Google Search Console MCP server for analytics, URL inspection, sitemaps, in
xactionsXActions - The Complete X/Twitter Automation Toolkit. Scrapers, MCP server for AI agents,
hermosoMarketing on autopilot, run from your own AI agent. 868 tools. Publishing, scheduling, ad
@0xinsider/mcpOfficial 0xinsider CLI and MCP server: advanced tools for sports and esports markets, powe
high-stakes-analytics-decision-labBuild or review source-backed descriptive, diagnostic, predictive, and prescriptive analys