@gehdoc/svg-to-video

MCPattested
v0.27.8GehDocMITUpdated 7d agonpmGitHub

Professional animated SVG to Video (MP4/WebM/MKV/MOV) and Animated Image (aPNG/GIF) converter featuring frame-accurate rendering, CLI automation, Model Context Protocol (MCP) server integration, and a serverless Web Studio.

Works in
ClaudeCursorCopilotGemini

Inferred from the transports this listing declares (stdio). A client not listed here hasn’t been ruled out — it just isn’t something Forge can confirm.

Attested build
A verified provenance attestation binds this artifact to the listed repository. Nobody has claimed the listing yet — this proves where the code was built, not who stands behind it.
2kDownloads/wk
4GitHub stars
2Forks
7d agoLast update
Package
AuthorGehDoc
LicenseMIT
Version0.27.8
Sourcenpm+mcp-registry
Trust Status
A
85/100Trusted
✓Listed in Forge index+10/10
✓Identity verified · attested build+20/20
—Ed25519 publish signature+0/5
→ Included automatically when the publisher runs `forge publish`
—Domain verification+0/5
→ Publisher: host /.well-known/forge.json on the package homepage with { "publisher": "<github-login>" }
✓npm Trusted Publishing (Sigstore)+5/5
—npm maintainer match+0/5
→ Publisher: add the verified GitHub login to the npm package's maintainers (npm owner add <login>)
✓CVE scan · clean+30/30
✓Static analysis · clean+20/20
Paste into Claude Code, Cursor, or any AI assistant to fix all gaps
StatusIdentity verified
PublisherUnverified
SignatureUnsigned
Domain—
Provenance✓ Sigstore-verified · 5ff9153
Dependencies✓ 60 resolved+ · none vulnerable
Tool surface2 tools · none privileged
Security scan✓ Cleanv0.27.8 · 6d agoHow well does this scan work?
EvalsNone
IndexedSep 27, 2026

Verification confirms publisher identity (repo ownership), not code safety. The security scan covers known CVEs and suspicious install scripts.

Tools

2 tools · none privileged
Statically extracted from the published packagev0.27.8 · 6d ago

Read out of the source npm actually ships, at scan time. The package was never executed. Tools registered dynamically at runtime, or hidden inside bundled or minified code, can be missed — so this is a floor on the tool surface, not a complete census of it.

render_svg_to_videoRender an animated SVG (from file path or raw SVG code) into a high-quality video (MP4, WebM, MKV, MOV) or animated image (aPNG, GIF) with optional background transparency.

Render an animated SVG (from file path or raw SVG code) into a high-quality video (MP4, WebM, MKV, MOV) or animated image (aPNG, GIF) with optional background transparency.

No input schema was published for this tool.

inspect_svg_animationAnalyze an SVG file or raw SVG content to detect CSS keyframe animations, estimate duration, and extract viewBox dimensions.

Analyze an SVG file or raw SVG content to detect CSS keyframe animations, estimate duration, and extract viewBox dimensions.

No input schema was published for this tool.

2 of 2 tools published a description.

Tool names and descriptions are written by the publisher and shown verbatim as inert text. They are the strings an MCP client passes to a model, so Forge scans them for prompt-injection patterns — any finding appears with the security scan above. “Privileged” is a keyword match on the tool name, not an audit of what the tool does: a benign-sounding name can still do anything.

About

Professional animated SVG to Video (MP4/WebM/MKV/MOV) and Animated Image (aPNG/GIF) converter featuring frame-accurate rendering, CLI automation, Model Context Protocol (MCP) server integration, and a serverless Web Studio.

Keywords
animationcssvideosvgconvertmp4webmapnggifgifencmetadatatransparencyalpha-channelweb-animations-apimcpmcp-servermodel-context-protocolagent-skill
Alternatives
Comparing tool surfaces…

Dependency tree

What one Forge scan resolved from npm metadata on 2026-09-30 — observed resolution, not a publisher declaration.

60 packages resolved · 6 direct · none carrying advisories Resolution stops at depth 4 and 60 packages.

The crawl stopped at the 60-package limit. The rest of the tree was never resolved.

36 more resolved packages are not drawn here (display cap: 24). Every dependency carrying an advisory is drawn regardless of the cap. Full inventory (CycloneDX SBOM)

Declared but not resolved

67 declared dependencies never landed in the tree. They are missing from Forge's resolution, not from the package.

+55 more not listed. The counts by reason above cover all of them.

Not followed: optionalDependencies, peerDependencies. This tree covers runtime dependencies only, so anything those pull in was never resolved.

Topics

Related in images, video & audio