mcp-use

Name: mcp-use
Author: mcp-use, Inc.

MCPattested

v1.28.0mcp-use, Inc.MITUpdated 4mo agonpm GitHub

Opinionated MCP Framework for TypeScript (@modelcontextprotocol/sdk compatible) - Build MCP Agents, Clients and Servers with support for ChatGPT Apps, Code Mode, OAuth, Notifications, Sampling, Observability and more.

mcp-use is the fullstack MCP framework to build MCP Apps for ChatGPT / Claude & MCP Servers for AI Agents. Build with mcp-use SDK (ts | py): MCP Servers and MCP Apps Preview on mcp-use MCP Inspector (online | oss): Test and debug your MCP Servers and Apps Deploy on Manufact MCP Cloud: Connect your GitHub repo and have your MCP Server and App up and running in production with observability,…

Works in

ClaudeCursorCopilotGemini

Inferred from the transports this listing declares (stdio). A client not listed here hasn’t been ruled out — it just isn’t something Forge can confirm.

Attested build

A verified provenance attestation binds this artifact to the listed repository. Nobody has claimed the listing yet — this proves where the code was built, not who stands behind it.

10kGitHub stars

1kForks

4mo agoLast update

Package

Authormcp-use, Inc.

LicenseMIT

Version1.28.0

Sourcenpm+github

npmmcp-use

GitHubmcp-use/mcp-use

SBOMCycloneDX 1.6 ↓

Trust Status

85/100Trusted

✓Listed in Forge index+10/10

✓Identity verified · attested build+20/20

—Ed25519 publish signature+0/5

→ Included automatically when the publisher runs `forge publish`

—Domain verification+0/5

→ Publisher: host /.well-known/forge.json on the package homepage with { "publisher": "<github-login>" }

✓npm Trusted Publishing (Sigstore)+5/5

—npm maintainer match+0/5

→ Publisher: add the verified GitHub login to the npm package's maintainers (npm owner add <login>)

✓CVE scan · clean+30/30

✓Static analysis · clean+20/20

Paste into Claude Code, Cursor, or any AI assistant to fix all gaps

StatusIdentity verified

PublisherUnverified

SignatureUnsigned

Domain—

Provenance✓ Sigstore-verified · 9afeeb6

Dependencies✓ 42 resolved+ · none vulnerable

Tool surface2 tools · none privileged

Security scan✓ Cleanv2.2.3 · 1mo agoHow well does this scan work?

EvalsNone

IndexedMay 24, 2026

Verification confirms publisher identity (repo ownership), not code safety. The security scan covers known CVEs and suspicious install scripts.

Tools

2 tools · none privileged

Statically extracted from the published packagev2.2.3 · 1mo ago

Read out of the source npm actually ships, at scan time. The package was never executed. Tools registered dynamically at runtime, or hidden inside bundled or minified code, can be missed — so this is a floor on the tool surface, not a complete census of it.

addNo description published

This tool published no description. Forge does not invent one.

highlight-fruitNo description published

This tool published no description. Forge does not invent one.

0 of 2 tools published a description.

Tool names and descriptions are written by the publisher and shown verbatim as inert text. They are the strings an MCP client passes to a model, so Forge scans them for prompt-injection patterns — any finding appears with the security scan above. “Privileged” is a keyword match on the tool name, not an audit of what the tool does: a benign-sounding name can still do anything.

About

Keywords

mcpmcp-usemodel context protocolchatgpt appscode modeoauthnotificationssamplingsdkmcp-uimcp-inspectoraiutilitytypescriptagentic-frameworkapps-sdkchatgptclaude-codellmsmcp-appsmcp-clientmcp-gatewaymcp-hostmcp-servermcp-serversmcp-toolsmodel-context-protocolmodelcontextprotocolopenclawskills

Alternatives

Comparing tool surfaces…

mcp-use

Tools

Tools exposed

No dependency coverage