mcp-use

MCPattested
v1.28.0mcp-use, Inc.MITUpdated 3mo agonpmGitHub

Opinionated MCP Framework for TypeScript (@modelcontextprotocol/sdk compatible) - Build MCP Agents, Clients and Servers with support for ChatGPT Apps, Code Mode, OAuth, Notifications, Sampling, Observability and more.

mcp-use is the fullstack MCP framework to build MCP Apps for ChatGPT / Claude & MCP Servers for AI Agents. Build with mcp-use SDK (ts | py): MCP Servers and MCP Apps Preview on mcp-use MCP Inspector (online | oss): Test and debug your MCP Servers and Apps Deploy on Manufact MCP Cloud: Connect your GitHub repo and have your MCP Server and App up and running in production with observability,…

Attested build
A verified provenance attestation binds this artifact to the listed repository. Nobody has claimed the listing yet — this proves where the code was built, not who stands behind it.
10kGitHub stars
1kForks
3mo agoLast update
Package
Authormcp-use, Inc.
LicenseMIT
Version1.28.0
Sourcenpm+github
npmmcp-use
GitHubmcp-use/mcp-use
Trust Status
A
85/100Trusted
✓Listed in Forge index+10/10
✓Identity verified · attested build+20/20
—Ed25519 publish signature+0/5
→ Included automatically when the publisher runs `forge publish`
—Domain verification+0/5
→ Publisher: host /.well-known/forge.json on the package homepage with { "publisher": "<github-login>" }
✓npm Trusted Publishing (Sigstore)+5/5
—npm maintainer match+0/5
→ Publisher: add the verified GitHub login to the npm package's maintainers (npm owner add <login>)
✓CVE scan · clean+30/30
✓Static analysis · clean+20/20
Paste into Claude Code, Cursor, or any AI assistant to fix all gaps
StatusIdentity verified
PublisherUnverified
SignatureUnsigned
Domain—
Provenance✓ Sigstore-verified · 9afeeb6
Dependencies✓ 42 resolved+ · none vulnerable
Tool surface2 tools · none privileged
Security scan✓ Cleanv2.2.3 · 2d ago
EvalsNone
IndexedMay 24, 2026

Verification confirms publisher identity (repo ownership), not code safety. The security scan covers known CVEs and suspicious install scripts — it cannot prove the absence of malicious code.

About

mcp-use is the fullstack MCP framework to build MCP Apps for ChatGPT / Claude & MCP Servers for AI Agents. Build with mcp-use SDK (ts | py): MCP Servers and MCP Apps Preview on mcp-use MCP Inspector (online | oss): Test and debug your MCP Servers and Apps Deploy on Manufact MCP Cloud: Connect your GitHub repo and have your MCP Server and App up and running in production with observability, metrics, logs, branch-deployments, and more Visit our docs or jump to a quickstart (TypeScript | Python)…

Keywords
mcpmcp-usemodel context protocolchatgpt appscode modeoauthnotificationssamplingsdkmcp-uimcp-inspectoraiutilitytypescriptagentic-frameworkapps-sdkchatgptclaude-codellmsmcp-appsmcp-clientmcp-gatewaymcp-hostmcp-servermcp-serversmcp-toolsmodel-context-protocolmodelcontextprotocolopenclawskills