tirth8205/code-review-graph

COLLECTIONcommunity
tirth8205MITUpdated 3mo agoGitHub

Local-first code intelligence graph for MCP and CLI. Builds a persistent map of your codebase so AI coding tools read only what matters, with benchmarked context reductions on reviews and large-repo workflows.

Stop burning tokens. Start reviewing smarter. Reproducing the benchmarks · AI coding tools can end up re-reading large parts of your codebase on review tasks. fixes that. It builds a structural map of your code with Tree-sitter, tracks changes incrementally, and gives your AI assistant precise context via MCP so it reads only what matters. One command sets up everything. detects which AI coding…

This collection bundles
7 skills1 MCP server

⚠ The trust score below reflects the collection's repository only. The bundled units are not individually verified or scanned — review them before use.

Automatically indexed from public sources. Not yet verified by the developer on Forge.Claim this listing →
18kGitHub stars
2kForks
3mo agoLast update
Package
Authortirth8205
LicenseMIT
Sourcegithub
Trust Status
B
60/100Good
✓Listed in Forge index+10/10
—Publisher identity verified+0/30
→ Publisher: run `forge publish` from the repo to claim ownership
—Domain verification+0/10
→ Not currently available for this listing type — the domain-verification check only runs for npm-backed packages today, so this row cannot be earned here yet regardless of what's hosted at the domain.
✓Prompt-injection scan · clean+30/30
✓Obfuscation / exfil scan · clean+20/20
Paste into Claude Code, Cursor, or any AI assistant to fix all gaps
StatusCommunity-indexed
PublisherUnverified
SignatureUnsigned
Domain—
Provenance—
DependenciesNot audited
Tool surface—
Security scan✓ CleanvHEAD · 3mo agoHow well does this scan work?
EvalsNone
IndexedJun 14, 2026

Verification confirms publisher identity (repo ownership), not code safety. The security scan covers known CVEs and suspicious install scripts.

Tools

No tool declarations found in the source3mo ago

Forge read 28 source files from the repository archive and matched no MCP tool registrations. Extraction is pattern-based over shipped source: a server that builds its tool list at runtime, or that ships only bundled or minified code, registers nothing this can see. Treat it as “not detected”, not as “exposes none”.

About

Stop burning tokens. Start reviewing smarter. Reproducing the benchmarks · AI coding tools can end up re-reading large parts of your codebase on review tasks. fixes that. It builds a structural map of your code with Tree-sitter, tracks changes incrementally, and gives your AI assistant precise context via MCP so it reads only what matters. One command sets up everything. detects which AI coding tools you have, writes the correct MCP configuration for each one, installs platform-native…

Keywords
ai-codingclaudeclaude-codecode-reviewgraphragincrementalknowledge-graphllmmcppythonstatic-analysistree-sittercollection
Alternatives
Comparing tool surfaces…

No dependency coverage

This entry publishes no npm package, so Forge has no dependency tree for it. That is a gap in coverage — not a statement that it has no dependencies.

Topics

Related in memory & knowledge graphs